Thanks for that sequence, I can really picture it now
dekhn 177 days ago [-]
You can search for it here:
https://alphafold.ebi.ac.uk/search/sequence/KSSEPASVSAAERRAE...
and in principle get the AlphaFold predicted structure (I couldn't find an experimentally determined one). However, like nearly all EBI resources, the web server timed out before I could get a link to the prediction.
immibis 177 days ago [-]
Isn't it strange to see protein codes spreading the same way magnet links or AACS encryption keys might.
That doesn't look right. I think the problem is in the last quarter. Exercise for the reader.
sunrunner 177 days ago [-]
This looks like an puzzle input to a day from Advent of Code.
BurningFrog 176 days ago [-]
How hard is it to manufacture once you know the sequence?
hinkley 177 days ago [-]
> Infused in the bloodstream, scavenger hemoproteins like RcoM-HBD-CCC rapidly bind to carbon monoxide molecules, reducing the time it takes to clear half of the carbon monoxide in the blood to less than a minute, compared to more than hour with pure oxygen therapy and five hours without any treatment.
lawlessone 177 days ago [-]
I can see a market in selling this to urban cyclists..
I've seen people doing that get quite a bit of exhaust fumes to the face.
hinkley 177 days ago [-]
Breath control is an underrated skill.
177 days ago [-]
searine 177 days ago [-]
This research was funded by multiple NIH grants, a Department of Defense grant, and the Martin Family Foundation.
kazinator 177 days ago [-]
The existing methylene blue substance is also effective in cases of CO poisoning.
"Methylene Blue as an Antidote to CO Poisoning", Matilda Moldenhauer Brooks
skadamou 177 days ago [-]
This paper is interesting but I want to point out there is a difference between a research paper showing that something is hypothetically feasible and something that is actually useful clinically.
Clinically, methylene blue is used to treat a different condition, methemeglobinemia and is not used to treat carbon monoxide poisoning which relies on hyperbaric oxygen therapy.
kazinator 177 days ago [-]
The researcher used non-human animals; it worked on them.
The hypothetical part was only that it might also work on humans.
In any case, it seems the result was good enough as a clinical trial from the point of view of veterinary medicine, in regard to those specific types of animals.
amy_petrik 176 days ago [-]
We really shouldn't be taking chemicals used on animals for veteran purposes and use them on humans too. For example, ivermectin. It's a drug meant for horses similar to another horse tranquilizer, ketamine. Can you imagine a human taking ivermectin or ketamine?!? I remember during COVID people were shooting up horse medicine and it was just really bad and upsetting, like these people were crazy. I wish Kamala had won and would have banned this horse medicines like ivermectin.
And now this whole methylene blue thing, RFK takes methylene blue. I mean, guys, this isn't even a horse veteran medicine, it's basically ink used to stain cells. I'm sorry, but everything that has an ink or pigmented color it, there is no way on earth it has a medicinal purpose. I mean. It's ink, nothing more.
kazinator 176 days ago [-]
> We really shouldn't be taking chemicals used on animals for veteran purposes and use them on humans too.
While I totally agree in principle, the specific substance in question (methylene blue) is used on humans already (or should I add was used, at the time of the 1933 study), and for a related emergency purpose: fixing hemoglobin that is poisoned in a certain way, giving rise to a condition called methemoglobinemia.
> And now this whole methylene blue thing, RFK takes methylene blue.
I have no idea about that; I don't follow tabloid stuff.
Methylene blue isn't a now thing; it's been known for a hundred years or more.
> there is no way on earth it has a medicinal purpose
You might be in for a surprise when you do a 15 second web search on it.
RFK playing around with methylene blue doesn't mean anything. If he happens to ascribing to it properties it doesn't have and using it for situations for which it has not been proven, he's engaging in dangerous quackery.
People kill themselves with fentanyl, yet it's an important drug, and on the World Health's Organization list of Essential Medicines: https://list.essentialmeds.org/ (scroll down to the F section).
Oh, look what else is in this list of essential medicines! Methylthioninium chloride. A.k.a. methylene blue.
Yet here you are, claiming that there is no way it has a medicinal purpose?! But you're sure you are smarter than that RFK.
phatskat 176 days ago [-]
> Can you imagine a human taking ivermectin or ketamine?!?
While I can only believe the ivermectin stuff because it happened (and the crossover of people who took it is pretty strong with people likely to think drinking bleach cures autism…), I 100% can believe people take ketamine because I have, and I will again - it’s fun!
Note to the curious: always do your homework. Start at Erowid and learn about any new drug, be sure to get reliably safe drugs, and the golden rule (via Rick and Morty during a Deadmau5 NYE of all places): you can always take more drugs, but you can never take less.
sandworm101 177 days ago [-]
CO poisioning is one of those strange cases treatable using scuba diving. Recompression therapy, which can be theoretically aped under water, can be like magic. In some cases the patient just wakes up like nothing is wrong. No drugs. No invasive treatment. Get deep enough and hemoglobin isnt totally necessary for getting O2 where it needs to be.
I guess CO kills you because it sticks to a protein (Hemoglobin), this is a protein that it binds even tighter to.
What I find hilarious though is that my RSS reader loves to show me articles about ways of turning the harmful gas CO2 into the useful gas CO, back when I was a kid it was the other way around!
bananapub 177 days ago [-]
not very on topic, but for those who missed one of the more surreal reddit threads in history:
It looks like he found a note in his room and see some strange thing in the window, and someone somehow says it's CO but it may be that the OP has unrelated hallucinations. Is this a symptom of CO poisoning? I think you only get sleepy, faint and die.
maxbond 177 days ago [-]
Chronic exposure can lead to memory loss, yes. You're describing the symptoms of acute exposure.
phatskat 176 days ago [-]
Reading in a bit more, the second post links to a comment thread where further down they talk about post-it notes.
The original thread about the post its had some updates along the lines of: someone in comments suggested OP get a CO detector. OP says “ya know, I have one. Maybe I should take it out of the box and plug it in.” Later OP said their detector rated the CO at 100ppm! They went to the hospital lol.
Last update I saw was four months after - OP was guessing their recovery would go on for another year, and there was likely some permanent damage but overall they felt confident at getting back to 80%, maybe even 99%.
hinkley 177 days ago [-]
CO exposure is accumulative. If you’re around an intense source of it you’re toast. But with a small point source or decent ventilation it kills you slower.
And your body produces new blood cells every day, so minor sources like wood smoke or burning a candle don’t dose you enough to be a problem, unless perhaps your day job is as an athlete.
hinkley 177 days ago [-]
Also looks like the half-life of CO in the blood is around five hours.
dtgriscom 177 days ago [-]
How is this administered? Seems like a crucial detail to omit.
elric 177 days ago [-]
> This has the potential to become a rapid, intravenous antidote for carbon monoxide
So intravenously, presumably.
DonHopkins 177 days ago [-]
You can spread it on bread, melt it over pancakes, rub it all over corn on the cob, put it in baked potatoes, etc, promise!
177 days ago [-]
pfdietz 177 days ago [-]
This looks like a therapy you can only get once in your life, after which it has acted like a vaccine and your immune system would react to it.
dekhn 176 days ago [-]
Typically, protein therapeutics are "humanized" before being pushed through the drug approval process. Part of that is ensuring that the therapeutic isn't extremely likely to trigger an immune response. It's a nontrivial problem.
pfdietz 176 days ago [-]
Those are usually antibodies, aren't they? This isn't an antibody.
The same techniques, however, do not. So how does one humanize an arbitrary protein?
isk517 177 days ago [-]
If getting carbon monoxide poisoning once isn't enough to make you invest in a few detectors then I don't know what will
176 days ago [-]
DonHopkins 177 days ago [-]
>New Protein Therapy Shows Promise as Antidote for Carbon Monoxide Poisoning
So Shatner was right all along: not only is Promise Margarine good for lowering your cholesterol level, but it can also treat carbon monoxide poisoning! And it tastes like butter, promise.
I don't see a relation of any kind and I hate commercials maybe more than anybody else, but it's always a good time for a funny one with Shatner :)
DonHopkins 177 days ago [-]
Sheez, I can't believe I have to explain that Shatner shows Promise as antidote for high cholesterol too.
selimthegrim 177 days ago [-]
He just played New Orleans. Somebody should’ve been throwing tubs of Promise margarine at the stage.
177 days ago [-]
heyoleftycunts 177 days ago [-]
[flagged]
narrator 177 days ago [-]
[flagged]
skadamou 177 days ago [-]
Methylene blue is actually used to treat acquired cases of a similar condition called methemeglobinemia which is when the iron in heme is oxide from Fe2+ to Fe3+ [1]. This is different from carbon monoxide poisoning which is caused by carbon monoxide binding more tightly to hemoglobin than oxygen preventing oxygen from effectively getting into your blood.
Ahh I bet that is where the confusion is. I am a physician and I have used methylene blue in severe shock and methemoglobinemia but I was a bit worried the parent comment believed it’s a valid CO treatment.
kazinator 177 days ago [-]
Initially suspecting that since CO poisoning and methemeglobinemia are not the same, methylene blue might not work in CO cases, I did about three seconds of web searching and found a 1933 paper about an experiment (on animals) showing methylene blue to be effective in CO poisoning.
Herodotus38 177 days ago [-]
Hello, I would be interested if you could give evidence that methylene blue "works great" for carbon monoxide poisoning in humans.
IANAMD I made a quick search and the evidence of methylene blue as a carbon monoxide antidote looks controversial.
IIUC part of the effect is oxidizing/reducing the iron atom in the hemoglobin, and that changes how strong is the bound with the O2, CO, NO. But my chemistry is not enough to give a good guess of the results.
God forbid we have alternatives that work in minutes
lagniappe 177 days ago [-]
Given that MB is commonly supported by those with right leaning politics, if the above is true, it won't be reported on for risk of appearing to support the "wrong" party.
darth_avocado 177 days ago [-]
Why would a treatment be not made available if it’s effective? What’s the conspiracy in letting people suffer and die?
immibis 177 days ago [-]
Well, money would be the most obvious one, but the parent comment is talking about the anti-science regime currently in power in the USA. I can't remember which, but I thought I read they banned some effective treatments because RFK Jr (famous conspiracy theorist now in charge of the country's health) didn't believe in them. They shut down research into mRNA medicines. at least, because they think it's population control to keep you docile, or something like that. There was also a mass shooting at a CDC office on similar grounds.
jayd16 177 days ago [-]
It's been around for a century but it's a political conspiracy to keep it unknown??
Traubenfuchs 177 days ago [-]
[flagged]
jrajav 177 days ago [-]
"hey, speeding down the highway 35mph over the limit could kill you, especially if you are fat and old. you SHOULD drive under the speed limit, but you don't have to."
No, the point is that it could kill other people. Speed all you want when you're on your own private roads.
Laws are generally meant to ensure public safety and the ability for us to live and cooperate together with mutual trust. They usually do end up restricting your personal freedoms to that end. Deal with it.
177 days ago [-]
tekno45 177 days ago [-]
[flagged]
Rendered at 10:05:29 GMT+0000 (Coordinated Universal Time) with Vercel.
KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRILMIKVSSMIAAGGASGTSMIFYDVTDLTTEPSGLPAGGSAPSHHHHHH
It is a protein encoding the PxRcoM-1 heme binding domain with C94S mutation and a C-terminal 6xHis tag (RcoM-HBD-C94S)
[1] https://www.pnas.org/doi/10.1073/pnas.2501389122#supplementa...
I've seen people doing that get quite a bit of exhaust fumes to the face.
1933 paper:
https://journals.physiology.org/doi/abs/10.1152/ajplegacy.19...
"Methylene Blue as an Antidote to CO Poisoning", Matilda Moldenhauer Brooks
Clinically, methylene blue is used to treat a different condition, methemeglobinemia and is not used to treat carbon monoxide poisoning which relies on hyperbaric oxygen therapy.
The hypothetical part was only that it might also work on humans.
In any case, it seems the result was good enough as a clinical trial from the point of view of veterinary medicine, in regard to those specific types of animals.
And now this whole methylene blue thing, RFK takes methylene blue. I mean, guys, this isn't even a horse veteran medicine, it's basically ink used to stain cells. I'm sorry, but everything that has an ink or pigmented color it, there is no way on earth it has a medicinal purpose. I mean. It's ink, nothing more.
While I totally agree in principle, the specific substance in question (methylene blue) is used on humans already (or should I add was used, at the time of the 1933 study), and for a related emergency purpose: fixing hemoglobin that is poisoned in a certain way, giving rise to a condition called methemoglobinemia.
> And now this whole methylene blue thing, RFK takes methylene blue.
I have no idea about that; I don't follow tabloid stuff.
Methylene blue isn't a now thing; it's been known for a hundred years or more.
> there is no way on earth it has a medicinal purpose
You might be in for a surprise when you do a 15 second web search on it.
RFK playing around with methylene blue doesn't mean anything. If he happens to ascribing to it properties it doesn't have and using it for situations for which it has not been proven, he's engaging in dangerous quackery.
People kill themselves with fentanyl, yet it's an important drug, and on the World Health's Organization list of Essential Medicines: https://list.essentialmeds.org/ (scroll down to the F section).
Oh, look what else is in this list of essential medicines! Methylthioninium chloride. A.k.a. methylene blue.
Yet here you are, claiming that there is no way it has a medicinal purpose?! But you're sure you are smarter than that RFK.
While I can only believe the ivermectin stuff because it happened (and the crossover of people who took it is pretty strong with people likely to think drinking bleach cures autism…), I 100% can believe people take ketamine because I have, and I will again - it’s fun!
Note to the curious: always do your homework. Start at Erowid and learn about any new drug, be sure to get reliably safe drugs, and the golden rule (via Rick and Morty during a Deadmau5 NYE of all places): you can always take more drugs, but you can never take less.
https://www.ncbi.nlm.nih.gov/books/NBK470531/
What I find hilarious though is that my RSS reader loves to show me articles about ways of turning the harmful gas CO2 into the useful gas CO, back when I was a kid it was the other way around!
- [MA] Post-it notes left in apartment [0]
- and the update from OP a while later [1]
[0]: https://www.reddit.com/r/legaladvice/comments/34l7vo/ma_post...
[1]: https://www.reddit.com/r/AskReddit/comments/49zfvb/what_is_t...
The original thread about the post its had some updates along the lines of: someone in comments suggested OP get a CO detector. OP says “ya know, I have one. Maybe I should take it out of the box and plug it in.” Later OP said their detector rated the CO at 100ppm! They went to the hospital lol.
Last update I saw was four months after - OP was guessing their recovery would go on for another year, and there was likely some permanent damage but overall they felt confident at getting back to 80%, maybe even 99%.
And your body produces new blood cells every day, so minor sources like wood smoke or burning a candle don’t dose you enough to be a problem, unless perhaps your day job is as an athlete.
So intravenously, presumably.
https://en.wikipedia.org/wiki/Humanized_antibody
So Shatner was right all along: not only is Promise Margarine good for lowering your cholesterol level, but it can also treat carbon monoxide poisoning! And it tastes like butter, promise.
https://www.youtube.com/watch?v=n3wf717fKFE
[1] https://www.uptodate.com/contents/methemoglobinemia?search=m...
It is not the standard of care in any guidelines I can find from any country. There is a paper from 2018 out of china showing some benefit in a rat model: https://onlinelibrary.wiley.com/doi/10.1111/bcpt.12940
IIUC part of the effect is oxidizing/reducing the iron atom in the hemoglobin, and that changes how strong is the bound with the O2, CO, NO. But my chemistry is not enough to give a good guess of the results.
https://www.reddit.com/r/medlabprofessionals/comments/16lep3...
https://www.youtube.com/watch?v=9GYtgFdXCGE
No, the point is that it could kill other people. Speed all you want when you're on your own private roads.
Laws are generally meant to ensure public safety and the ability for us to live and cooperate together with mutual trust. They usually do end up restricting your personal freedoms to that end. Deal with it.